Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSF RACFKSIFRIHTETG
    • Amino acids

      72 to 136
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Adiponectin Receptor 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACDCR1
    • ADIPO R1
    • Adiponectin receptor protein 1
    • ADIPOR 1
    • Adipor1
    • ADR1_HUMAN
    • CGI 45
    • CGI 45 protein
    • CGI-45
    • CGI45
    • CGI45 protein
    • FLJ25385
    • FLJ42464
    • PAQR1
    • Progestin and adipoQ receptor family member I
    • TESBP1A
    see all
  • Function

    Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin.
  • Tissue specificity

    Widely expressed. Highly expressed in skeletal muscle. Expressed at intermediate level in brain, heart, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.
  • Sequence similarities

    Belongs to the ADIPOR family.
  • Domain

    The N-terminus is known to be cytoplasmic while the C-terminus is known to be extracellular.
  • Cellular localization

    Membrane. Localized to the cell membrane and intracellular organelles.
  • Information by UniProt

Images

  • ab153328 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up