Description

  • Product name

    Recombinant human ADK protein (Active)
    See all ADK proteins and peptides
  • Biological activity

    Specific activity is > 30 pmol/min/µg and is defined as the amount of enzyme that converts 1.0 pmole of adenosine to AMP per minute at pH 7.5 at 37°C in a couple system with PK and LDH.

  • Purity

    > 95 % SDS-PAGE.
    ab227392 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMRENILFGMGNPLLDISAVVDKDFLDKYSL KPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKA ATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRS LIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVA HHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFARE QGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRR TGCTFPEKPDFH
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      22 to 362
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006712.

Specifications

Our Abpromise guarantee covers the use of ab227392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    Functional Studies

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.03% EDTA, 20% Glycerol, 0.29% Sodium chloride, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2310026J05Rik
    • 5033405D03Rik
    • Adenosine 5''-phosphotransferase
    • Adenosine kinase
    • adk
    • ADK_HUMAN
    • AI255373
    • AI987814
    • AK
    • MGC6593
    • OTTHUMP00000019864
    • OTTHUMP00000019865
    see all
  • Function

    ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides.
  • Tissue specificity

    Widely expressed. Highest level in placenta, liver, muscle and kidney.
  • Pathway

    Purine metabolism; AMP biosynthesis via salvage pathway; AMP from adenosine 3',5'-bisphosphate: step 1/1.
  • Sequence similarities

    Belongs to the carbohydrate kinase pfkB family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227392.

References

ab227392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up