Overview

  • Product name

    Recombinant Human ADPGK protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGP VSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSP GNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFP GAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESL QEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSL EEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELAS MTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVP DVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQL AAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNK PVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
    • Molecular weight

      81 kDa including tags
    • Amino acids

      1 to 497

Specifications

Our Abpromise guarantee covers the use of ab132638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610017G09Rik
    • ADP dependent glucokinase
    • ADP GK
    • ADP-dependent glucokinase
    • ADP-GK
    • ADPGK
    • ADPGK_HUMAN
    • ATP dependent glucokinase
    • DKFZP434B195
    • RbBP 35
    • RbBP-35
    see all
  • Function

    Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency.
  • Pathway

    Carbohydrate degradation; glycolysis.
  • Sequence similarities

    Belongs to the ADP-dependent glucokinase family.
    Contains 1 ADPK (ADP-dependent kinase) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132638 stained with Coomassie Blue.

References

ab132638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up