Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDG EKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLY YLLAKHYQDCMEDMDGRAPGGASVHNAMQL KPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGR MTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSG YFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTS LSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIA GCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 357
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 49% Phosphate Buffer, 0.88% Sodium chloride, 50% Glycerol

    Supplied as a 0.2 µM
    filtered solution

General Info

  • Alternative names
    • [Protein ADP-ribosylarginine] hydrolase
    • ADP-ribose-L-arginine cleaving enzyme
    • ADP-ribosylarginine hydrolase
    • ADPRH
    • ADPRH_HUMAN
    • ARH1
    • EC 3.2.2.19
    see all
  • Function
    Catalyzes the reverse reaction of mono-ADP-ribosylation.
  • Sequence similarities
    Belongs to the ADP-ribosylglycohydrolase family.
  • Information by UniProt

Images

  • SDS-PAGE gel showing ab172180 under reduced (lane 1) and non-reduced (lane 2) conditions

References

ab172180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up