Description

  • Product name

    Recombinant Human ADRM1/ARM-1 protein
    See all ADRM1/ARM-1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab124570 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMTTSGALFPSLVPGSRGASNKYLVEF RAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIF PDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNE YLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAG LGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTR ATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNV PAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADE IQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEA FAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 407
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as ADRM1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 110 kDa cell membrane glycoprotein
    • adhesion regulating molecule 1
    • Adhesion-regulating molecule 1
    • ADRM 1
    • Adrm1
    • ADRM1_HUMAN
    • ARM 1
    • ARM-1
    • ARM1
    • Gp110
    • hRpn13
    • M(r) 110,000 surface antigen
    • Proteasomal ubiquitin receptor ADRM1
    • proteasome regulatory particle non ATPase 13
    • Proteasome regulatory particle non-ATPase 13
    • Regulatory particle non ATPase 13
    • Rpn13
    • Rpn13 homolog
    see all
  • Function

    Functions as a proteasomal ubiquitin receptor. Recruits the deubiquitinating enzyme UCHL5 at the 26S proteasome and promotes its activity.
  • Sequence similarities

    Belongs to the ADRM1 family.
    Contains 1 PH domain.
  • Domain

    The PH domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab124570.

References

ab124570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up