Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLL AQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVV IHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQ RQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLAN QYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKIL VEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEV QYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRE SMIQLF
    • Amino acids
      1 to 456
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (Ade(-)H, complement of
    • acidic isozyme
    • ADEH
    • Adenylosuccinate synthetase
    • Adenylosuccinate synthetase (Ade(-)H complementing)
    • Adenylosuccinate synthetase acidic isozyme
    • Adenylosuccinate synthetase isozyme 2
    • Adenylosuccinate synthetase liver isozyme
    • ADSS
    • AdSS 2
    • AMPSase 2
    • IMP--aspartate ligase 2
    • L-type adenylosuccinate synthetase
    • liver isozyme
    • PURA2_HUMAN
    see all
  • Function
    Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first commited step in the biosynthesis of AMP from IMP.
  • Pathway
    Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 1/2.
  • Sequence similarities
    Belongs to the adenylosuccinate synthetase family.
  • Cellular localization
    Cytoplasm. Partially associated with particulate fractions.
  • Information by UniProt

Images

  • ab157865 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up