Recombinant Human ADSSL1 protein (ab165184)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVV DLLATDADIISRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGN GVVIHLPGLFEEAEKNEKKGLKDWEKRLIISDRAHLVFDFHQAVDGLQEV QRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFSSRFKNLA HQHQSMFPTLEIDIEGQLKRLKGFAERIRPMVRDGVYFMYEALHGPPKKI LVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA YTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYA HMVNGFTALALTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVE VEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVGKSR ESMIQLF
    • Amino acids
      1 to 457
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenylosuccinate synthase like 1
    • Adenylosuccinate synthetase
    • Adenylosuccinate synthetase isozyme 1
    • AdSS 1
    • ADSS1
    • ADSSL1
    • AMPSase 1
    • basic isozyme
    • IMP aspartate ligase 1
    • IMP--aspartate ligase 1
    • M-type adenylosuccinate synthetase
    • muscle isozyme
    • PURA1_HUMAN
    see all
  • Function
    Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first commited step in the biosynthesis of AMP from IMP.
  • Tissue specificity
    Predominantly expressed in skeletal muscle and heart, as well as in several hematopoietic cell lines and solid tumors.
  • Pathway
    Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 1/2.
  • Sequence similarities
    Belongs to the adenylosuccinate synthetase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab165184 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up