Overview

  • Product name

    Recombinant Human AEBP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEA EAVAALLLNGGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEE DDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAASSSSGD GDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSG GRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGS TTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWK GCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHV PTHFSQQNSSK VSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDF FDAQTLDAIRHRAICFNLSAHIE SLGKGHSVVFHSTVIAKRKEDSGKI KLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKL PKDTALLLDPNIY RTMPQKRLKR
    • Molecular weight

      54 kDa including tags
    • Amino acids

      2 to 503

Specifications

Our Abpromise guarantee covers the use of ab135022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Adipocyte enhancer binding protein 2
    • Adipocyte enhancer-binding protein 2
    • AE (adipocyte enhancer) binding protein 2
    • AE binding protein 2
    • AE-binding protein 2
    • AEBP 2
    • AEBP2
    • AEBP2_HUMAN
    • MGC17922
    • Zinc finger protein AEBP2
    see all
  • Function

    DNA-binding transcriptional repressor. May interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3.
  • Sequence similarities

    Belongs to the AEBP2/jing C2H2-type zinc-finger family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab135022 stained with Coomassie Blue.

References

ab135022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up