Recombinant Human AFAP1L2 protein (ab164623)

Overview

  • Product name
    Recombinant Human AFAP1L2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSS DEEYIYMNKVTINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDL PPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEAVSSSYESYDE EDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKD NRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIV LGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK YLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPV ERSLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVG CEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKT DPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYIDGLPSQDRQE ELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSFLHGP SSAQAQASSPTLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLES LEPEDPSLRITTVKIQTEQQRISFPPSCPDAVVATPPGASPPVKDRLRVT SAEIKLGKNRTEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETL LKCTDKEVLASLEQKLKEIDEECRGEESRRVDLELSIMEVKDNLKKAEAG PVTLGTTVDTTHLENVSPRPKAVTPASAPDCTPVNSATTLKNRPLSVVVT GKGTVLQKAKEWEKKGAS
    • Amino acids
      1 to 818
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Actin filament-associated protein 1-like 2
    • AF1L2_HUMAN
    • AFAP1-like protein 2
    • afap1l2
    • CTB-1144G6.4
    • KIAA1914
    • XB130
    see all
  • Function
    May play a role in a signaling cascade by enhancing the kinase activity of SRC. Contributes to SRC-regulated transcription activation.
  • Tissue specificity
    Detected in spleen and thyroid, and at lower levels in kidney, brain, lung and pancreas.
  • Sequence similarities
    Contains 2 PH domains.
  • Post-translational
    modifications
    Tyrosine phosphorylated (by SRC).
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164623 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up