Description

  • Product name

    Recombinant Human AFP + collagen type I protein
  • Purity

    > 90 % SDS-PAGE.
    ab169893 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESS GGSNIEF AAQIRSQVMTHLRVIYER
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 198

Specifications

Our Abpromise guarantee covers the use of ab169893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names

    • AFP
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • HPAFP
    see all
  • Relevance

    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties. Plasma. Synthesized by the fetal liver and yolk sac.
  • Cellular localization

    Secreted

References

ab169893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up