Overview

  • Product name

    Recombinant Human Agpat2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLL RHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQS ILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAM TVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIV PVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHR AMRTTFLHISKTPQENGATAGSGVQPAQ
    • Amino acids

      1 to 278
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1 acyl sn glycerol 3 phosphate acyltransferase beta
    • 1 acylglycerol 3 phosphate O acyltransferase 2
    • 1 AGP acyltransferase 2
    • 1 AGPAT2
    • 1-acyl-sn-glycerol-3-phosphate acyltransferase beta
    • 1-acylglycerol-3-phosphate O-acyltransferase 2
    • 1-AGP acyltransferase 2
    • 1-AGPAT 2
    • Agpat2
    • Berardinelli Seip congenital lipodystrophy
    • BSCL
    • BSCL1
    • EC 2.3.1.51
    • LPAAB
    • LPAAT beta
    • LPAAT-beta
    • Lysophosphatidic acid acyltransferase beta
    • PLCB_HUMAN
    see all
  • Function

    Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
  • Tissue specificity

    Expressed predominantly in heart and liver.
  • Pathway

    Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
  • Involvement in disease

    Defects in AGPAT2 are the cause of congenital generalized lipodystrophy type 1 (CGL1) [MIM:608594]; also known as Berardinelli-Seip congenital lipodystrophy type 1 (BSCL1) or Berardinelli-Seip syndrome. CGL1 is an autosomal recessive disorder characterized by marked paucity of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes.
  • Sequence similarities

    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
  • Domain

    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab161041 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up