Description

  • Product name

    Recombinant Human AGRP protein (His tag)
  • Purity

    > 85 % SDS-PAGE.
    ab202619 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAQMGLAPMEGIRRPDQALLPELPGL GLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCL GQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      21 to 132
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001129. Mature full length protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab202619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Agouti related neuropeptide
    • Agouti Related Protein Homolog
    • Agouti-related protein
    • Agrp
    • AGRP_HUMAN
    • AGRT
    • ART
    • ASIP2
    see all
  • Function

    Plays a role in weight homeostasis. Plays a role in the central control of feeding. Reduces food intake. Inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Acts primarily on MC3R and MC4R. Has very low activity with MC5R.
  • Tissue specificity

    Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.
  • Involvement in disease

    Genetic variations in AGRP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities

    Contains 1 agouti domain.
  • Domain

    The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
  • Cellular localization

    Secreted. Golgi apparatus lumen.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202619 (3 µg).

References

ab202619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up