Overview

  • Product name
    Recombinant Human AGTPBP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDE DEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
    • Amino acids
      1087 to 1186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCP1
    • 1700020N17Rik
    • 2310001G17Rik
    • 2900054O13Rik
    • 4930445M19Rik
    • 5730402G09Rik
    • AGTPBP 1
    • AGTPBP1
    • ATP/GTP binding protein 1
    • ATP/GTP-binding protein 1
    • BB114605
    • Carboxypeptidase tubulin
    • CBPC1_HUMAN
    • Cytosolic carboxypeptidase 1
    • DKFZp686M20191
    • KIAA1035
    • MGC90651
    • mKIAA1035
    • Nervous system nuclear protein induced by axotomy
    • Nervous system nuclear protein induced by axotomy protein 1 homolog
    • nmf243
    • NNA1
    • OTTHUMP00000021581
    • OTTHUMP00000063553
    • pcd
    • Purkinje cell degeneration
    • RP11-30C23.1
    • Soluble carboxypeptidase
    • Tubulinyl Tyr carboxypeptidase
    • Tyrosine carboxypeptidase
    see all
  • Function
    Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5.
  • Sequence similarities
    Belongs to the peptidase M14 family.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • ab161588 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up