Overview

  • Product name

    Recombinant Human AHAS protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METPAAAAPAGSLFPSFLLLACGTLVAALLGAAHRLGLFYQLLHKVDKAS VRHGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVT AVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAA STLLQNRGALQAVDQLSLFRPPGCGQHPHWEDGLPRWLHCCIGPCGSGRL AAFLPLDCVQLVWSLIIACPGPIP
    • Amino acids

      1 to 224
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ILVBL

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 209L8
    • Acetolactate synthase homolog
    • Acetolactate synthase like protein
    • acetolactate synthase, bacterial, homolog of
    • Acetolactate synthase-like protein
    • AHAS
    • FLJ39061
    • ILV2H
    • IlvB (bacterial acetolactate synthase) like
    • IlvB like protein
    • IlvB-like protein
    • Ilvbl
    • ILVBL_HUMAN
    • MGC1269
    • MGC19535
    see all
  • Tissue specificity

    Expressed in all tissues tested, with highest expression in heart, pancreas and placenta.
  • Sequence similarities

    Belongs to the TPP enzyme family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab161231 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up