Description

  • Product name

    Recombinant Human AHSG protein
    See all AHSG proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151889 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKV WPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQL LKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAAL AAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAK CNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAV PTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRH TFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVV DHHHHHH
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      19 to 367
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • 59 kDa bone sialic acid-containing protein
    • A2HS
    • Aa2-066
    • AHS
    • Ahsg
    • Ahsg alpha-2-HS-glycoprotein
    • Alpha 2 HS Glycoprotein
    • Alpha 2 Z globulin
    • Alpha-2-HS-glycoprotein
    • Alpha-2-HS-glycoprotein chain B
    • Alpha-2-Z-globulin
    • Asialofetuin
    • Ba alpha 2 glycoprotein
    • Ba-alpha-2-glycoprotein
    • BSP
    • Countertrypin
    • Fetua
    • FETUA_HUMAN
    • Fetuin , mouse, homolog of
    • Fetuin A
    • Fetuin-A
    • Glycoprotein PP63
    • HSGA
    • pp63
    see all
  • Function

    Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
  • Tissue specificity

    Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
  • Sequence similarities

    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-A-type domains.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up