Description

  • Product name

    Recombinant Human AICDA protein (denatured)
    See all AICDA proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDSLLMNRRKFLYQFKNVRWAKGRRETYLC YVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTW FTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLH RAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRIL LPLYEVDDLRDAFRTLGL
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 198
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human AICDA protein

Specifications

Our Abpromise guarantee covers the use of ab139251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Activation induced cytidine deaminase
    • Activation induced deaminase
    • Activation-induced cytidine deaminase
    • AICDA
    • AICDA_HUMAN
    • AID
    • ARP 2
    • ARP2
    • CDA 2
    • CDA2
    • Cytidine aminohydrolase
    • HIGM2
    • Integrated into Burkitt's lymphoma cell line Ramos
    see all
  • Function

    RNA-editing deaminase involved in somatic hypermutation, gene conversion, and class-switch recombination. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses.
  • Tissue specificity

    Strongly expressed in lymph nodes and tonsils.
  • Involvement in disease

    Defects in AICDA are the cause of hyper-IgM immunodeficiency syndrome type 2 (HIGM2) [MIM:605258]; also known as hyper-IgM syndrome 2. HIGM2 is an autosomal recessive disorder characterized by normal or elevated serum IgM levels with absence of IgG, IgA, and IgE, resulting in a profound susceptibility to bacterial infections. HIGM2 causes the absence of Ig class switch recombination (CSR), the lack of Ig somatic hypermutations, and lymph node hyperplasia caused by the presence of giant germinal centers.
  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139251.

References

ab139251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up