Overview

  • Product name

    Recombinant Human AKAP10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISV HSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA AHFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTIVLPYFIQFMELRRMEH LVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKKHETTASFLT DSLDKRLEDSGSAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRL EMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVN TFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSA MEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKE DAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHP LGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNL YYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSV KKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRE SEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQA QYDQPLEKSTKL
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 662

Specifications

Our Abpromise guarantee covers the use of ab132242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1500031L16Rik
    • A kinase (PRKA) anchor protein 10
    • A kinase anchor protein 10
    • A kinase anchor protein 10 mitochondrial
    • A-kinase anchor protein 10
    • AKA10_HUMAN
    • akap 10
    • AKAP-10
    • AKAP10
    • B130049N18Rik
    • D AKAP 2
    • D-AKAP-2
    • dakap 2
    • dakap2
    • Dual specific A kinase anchoring protein 2
    • Dual specificity A kinase-anchoring protein 2
    • mgc9410
    • MGC9414|
    • mitochondrial
    • Mitochondrial A kinase PPKA anchor protein 10
    • prka 10
    • PRKA10
    • Protein A kinase anchoring protein 10
    • Protein A kinase anchoring protein 10 mitochondrial precursor
    • Protein kinase A anchoring protein 10
    • Protein kinase A-anchoring protein 10
    see all
  • Function

    Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A and anchors them to the mitochondria or the plasma membrane. Although the physiological relevance between PKA and AKAPS with mitochondria is not fully understood, one idea is that BAD, a proapoptotic member, is phosphorylated and inactivated by mitochondria-anchored PKA. It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for assembling multiprotein complexes. With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and the downstream kinase.
  • Involvement in disease

    Genetic variations in AKAP10 are a cause of susceptibility to sudden cardiac death (SCD) [MIM:115080]. Unexpected rapid natural death due to cardiovascular collapse within one hour of initial symptoms. It is usually caused by the worsening of existing heart diseases. The sudden onset of symptoms, such as chest pain and cardiac arrhythmias, particularly ventricular tachycardia, can lead to the loss of consciousness and cardiac arrest followed by biological death. Note=Increased susceptibility to sudden cardiac death may be conferred by AKAP10 variants that are associated with markers of low vagus nerve sensitivity, e.g. fast basal heart rate and low heart rate variability.
  • Sequence similarities

    Contains 2 RGS domains.
  • Domain

    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization

    Mitochondrion. Membrane. Cytoplasm. Predominantly mitochondrial but also membrane associated and cytoplasmic.
  • Information by UniProt

Images

  • ab132242 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up