Description

  • Product name

    Recombinant Human AKAP5 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPK AGSEAADVARKCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKP LEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSNHSKIIEDSDC SIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVS NSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPL ETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEF DVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLV KNAIQLSIEQLVNEMASDDNKINNLLQ
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      1 to 427

Specifications

Our Abpromise guarantee covers the use of ab132675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A kinase (PRKA) anchor protein 5
    • A kinase anchor protein 5
    • A kinase anchor protein 79kDa
    • A kinase anchoring protein 75/79
    • A-kinase anchor protein 5
    • A-kinase anchor protein 79 kDa
    • AKAP 5
    • AKAP 75
    • AKAP 79
    • AKAP-5
    • Akap5
    • AKAP5_HUMAN
    • AKAP75
    • AKAP79
    • cAMP dependent protein kinase regulatory subunit II high affinity binding protein
    • cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein
    • H21
    see all
  • Function

    May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade.
  • Tissue specificity

    Predominantly in the cerebral cortex and the postsynaptic densities of the forebrain, and to a lesser extent in adrenal medulla, lung and anterior pituitary.
  • Sequence similarities

    Contains 1 AKAP domain.
  • Domain

    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization

    Membrane. Associated with particulate fractions.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132675 stained with Coomassie Blue.

References

ab132675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up