Description

  • Product name

    Recombinant Human AKAP7 protein
    See all AKAP7 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab88047 was purified by affinity chromatography.
  • Expression system

    Saccharomyces cerevisiae
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLE ETQNKNKPG EGSSVKTEAADQNGNDNENNRK

Specifications

Our Abpromise guarantee covers the use of ab88047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.921% Glutathione, 0.5% Triton-X-100, 0.0154% DTT, 1.19% HEPES, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • A kinase (PRKA) anchor protein 7
    • A kinase anchor protein 18 kD
    • A kinase anchor protein 7
    • A kinase anchor protein 7 isoform alpha
    • A kinase anchor protein 7 isoform beta
    • A kinase anchor protein 7 isoform gamma
    • A kinase anchor protein 7 isoforms alpha and beta
    • A kinase anchor protein 9 kDa
    • A kinase anchoring protein 18
    • A-kinase anchor protein 18 kDa
    • A-kinase anchor protein 7 isoforms alpha and beta
    • AKA7A_HUMAN
    • AKAP 18
    • AKAP 7
    • AKAP-7 isoforms alpha and beta
    • AKAP15
    • AKAP18
    • Akap7
    • HGNC377
    • OTTHUMP00000040266
    • Protein kinase A anchoring protein 7
    • Protein kinase A anchoring protein 7 isoform alpha
    • Protein kinase A anchoring protein 7 isoform beta
    • Protein kinase A anchoring protein 7 isoform gamma
    • Protein kinase A anchoring protein 7 isoforms alpha/beta
    • Protein kinase A-anchoring protein 7 isoforms alpha/beta
    see all
  • Function

    Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel.
  • Tissue specificity

    Expressed in brain, heart, lung, pancreas and skeletal muscle.
  • Cellular localization

    Apical cell membrane. Targeted predominantly to the apical membrane and Lateral cell membrane. Targeted predominantly to the lateral membrane.
  • Information by UniProt

References

ab88047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up