Overview

  • Product name

    Recombinant Human AKR1C2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHID SAHVYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDY VDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNH RLLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDP NSPVLLEDPV LCALAKKHKRTPALIA
    • Molecular weight

      29 kDa
    • Amino acids

      1 to 256

Specifications

Our Abpromise guarantee covers the use of ab151381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Additional notes

    Supplied as a 0.2 µM filtered solution.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (up to 6 months). Store at -20°C.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride

General Info

  • Alternative names

    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 3 alpha HSD3
    • 3 alpha hydroxysteroid dehydrogenase type III
    • 3-alpha-HSD3
    • AK1C2_HUMAN
    • AKR1C pseudo
    • AKR1C2
    • Aldo keto reductase family 1 member C2
    • Aldo-keto reductase family 1 member C2
    • BABP
    • Bile acid binding protein
    • Chlordecone reductase homolog
    • Chlordecone reductase homolog HAKRD
    • DD
    • DD-2
    • DD/BABP
    • DD2
    • DDH 2
    • DDH2
    • Dihydrodiol dehydrogenase 2
    • Dihydrodiol dehydrogenase/bile acid binding protein
    • Dihydrodiol dehydrogenase/bile acid-binding protein
    • FLJ53800
    • HAKRD
    • HBAB
    • MCDR 2
    • MCDR2
    • OTTHUMP00000044759
    • Pseudo chlordecone reductase
    • SRXY8
    • Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase
    • Trans-1
    • Type II dihydrodiol dehydrogenase
    • Type III 3 alpha hydroxysteroid dehydrogenase
    • Type III 3-alpha-hydroxysteroid dehydrogenase
    see all
  • Function

    Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab151381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up