Description

  • Product name

    Recombinant human AKR1C4 protein
    See all AKR1C4 proteins and peptides
  • Biological activity

    Specific activity is > 700 pmol/min/μg, and is defined as the amount of enzyme that catalyzes the reduction of 1.0 pmole 3-chlorobenzaldehyde in the presence of NADP per minute at pH 8.8 at 25°C.

  • Purity

    > 90 % SDS-PAGE.
    ab109831 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVP RNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLP KDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDP NSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIREN IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 343
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as HSD3a. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 3 alpha HSD1
    • 3-alpha-HSD1
    • 3-alpha-hydroxysteroid dehydrogenase type I
    • AK1C4_HUMAN
    • AKR1C4
    • Aldo keto reductase family 1 member C4
    • Aldo-keto reductase family 1 member C4
    • CDR
    • Chlordecone reductase
    • DD-4
    • DD4
    • Dihydrodiol dehydrogenase 4
    • HAKRA
    • HSD3a
    see all
  • Function

    Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha,17-beta-diol (3-alpha-diol). Also has some 20-alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route.
  • Tissue specificity

    Liver specific.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE image, using ab109831 at 3ug

References

ab109831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up