Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVP RNRAVEVTKLAIEAG FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMV QPALESSLKKLQLDY VDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLA KSIGVSNFNYRQLEM ILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHK LWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTS EDMKVLDGLNRNYRY VVMDFLMDHPDYPFSDEY
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 323
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes

    Previously labelled as HSD3a. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • 3 alpha HSD1
    • 3-alpha-HSD1
    • 3-alpha-hydroxysteroid dehydrogenase type I
    • AK1C4_HUMAN
    • AKR1C4
    • Aldo keto reductase family 1 member C4
    • Aldo-keto reductase family 1 member C4
    • CDR
    • Chlordecone reductase
    • DD-4
    • DD4
    • Dihydrodiol dehydrogenase 4
    • HAKRA
    • HSD3a
    see all
  • Function
    Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha,17-beta-diol (3-alpha-diol). Also has some 20-alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route.
  • Tissue specificity
    Liver specific.
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172176 under reduced (lane 1) and non reduced (lane 2) conditions

References

ab172176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up