Description

  • Product name

    Recombinant human AKT2 (mutated E17 K) protein
    See all AKT2 proteins and peptides
  • Biological activity

    130 nmol/min/mg

  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWM RAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEE RARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDA KEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITI TPPDRYDSLGLLELDQRTHFPQFSYSASIRE
    • Predicted molecular weight

      85 kDa including tags
    • Amino acids

      1 to 481
    • Modifications

      mutated E17 K
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.005% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Akt2
    • AKT2_HUMAN
    • HIHGHH
    • Murine thymoma viral (v-akt) homolog 2
    • murine thymoma viral (v-akt) homolog-2
    • Oncogene AKT2 protein kinase B beta
    • PKB
    • PKB beta
    • PKBB
    • PKBBETA
    • PRKBB
    • Protein kinase Akt 2
    • Protein kinase Akt-2
    • Protein kinase B beta
    • RAC beta
    • rac protein kinase beta
    • RAC-BETA
    • RAC-beta serine/threonine-protein kinase
    • RAC-PK-beta
    • RACbeta
    • v akt murine thymoma viral oncogene homolog 2
    • V-AKT murine thymoma viral oncogene homolog 2
    see all
  • Function

    General protein kinase capable of phosphorylating several known proteins.
  • Tissue specificity

    Expressed in all human cell types so far analyzed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylation on Thr-309 and Ser-474 is required for full activity.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT2 ubiquitination. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Information by UniProt

Images

  • The specific activity of ab177258 was determined to be 130 nmol /min/mg.

     

  • SDS-PAGE analysis of ab177258.

References

ab177258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up