Recombinant human AKT2 (mutated E17 K) protein (ab177258)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWM RAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTE SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEE RARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDA KEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITI TPPDRYDSLGLLELDQRTHFPQFSYSASIRE
    • Molecular weight
      85 kDa including tags
    • Amino acids
      1 to 481
    • Modifications
      mutated E17 K
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    130 nmol/min/mg

  • Applications

    SDS-PAGE

    Functional Studies

    Western blot

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Akt2
    • AKT2_HUMAN
    • HIHGHH
    • murine thymoma viral (v-akt) homolog-2
    • PKB
    • PKB beta
    • PKBB
    • PKBBETA
    • PRKBB
    • Protein kinase Akt 2
    • Protein kinase Akt-2
    • Protein kinase B beta
    • rac protein kinase beta
    • RAC-BETA
    • RAC-beta serine/threonine-protein kinase
    • RAC-PK-beta
    • v akt murine thymoma viral oncogene homolog 2
    see all
  • Function
    General protein kinase capable of phosphorylating several known proteins.
  • Tissue specificity
    Expressed in all human cell types so far analyzed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation on Thr-309 and Ser-474 is required for full activity.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT2 ubiquitination. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Information by UniProt

Images

  • The specific activity of ab177258 was determined to be 130 nmol /min/mg.

     

  • SDS-PAGE analysis of ab177258.

References

ab177258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up