Description

  • Product name

    Recombinant human AKT2 protein
    See all AKT2 proteins and peptides
  • Biological activity

    Specific Activity: 5.9 pmol/min/µg.
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAEC QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREE WMRAIQMVANSLKQRAPGEDPM DYKCGSPSDSSTTEEMEVAVSKARAK VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM KILRKEVIIAKDEV AHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH LS RERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKIT DFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVM YEMMCGRLPFYNQDHERLFE LILMEEIRFPRTLSPEAKSLLAGLLKKD PKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK KLLPPFKPQVTSEVDT RYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR E
    • Amino acids

      1 to 481
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Recombinant full-length human AKT2 was co-expressed with PDK1 by baculovirus infection in Sf9 insect cells.

Specifications

Our Abpromise guarantee covers the use of ab79798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.1% Imidazole
    Constituents: 0.0462% DTT, 0.395% Tris HCl, 50% Glycerol, 0.58% Sodium chloride, Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Akt2
    • AKT2_HUMAN
    • HIHGHH
    • Murine thymoma viral (v-akt) homolog 2
    • murine thymoma viral (v-akt) homolog-2
    • Oncogene AKT2 protein kinase B beta
    • PKB
    • PKB beta
    • PKBB
    • PKBBETA
    • PRKBB
    • Protein kinase Akt 2
    • Protein kinase Akt-2
    • Protein kinase B beta
    • RAC beta
    • rac protein kinase beta
    • RAC-BETA
    • RAC-beta serine/threonine-protein kinase
    • RAC-PK-beta
    • RACbeta
    • v akt murine thymoma viral oncogene homolog 2
    • V-AKT murine thymoma viral oncogene homolog 2
    see all
  • Function

    General protein kinase capable of phosphorylating several known proteins.
  • Tissue specificity

    Expressed in all human cell types so far analyzed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylation on Thr-309 and Ser-474 is required for full activity.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT2 ubiquitination. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Information by UniProt

Images

  • Anti-AKT2 antibody (ab78666) + Recombinant human AKT2 protein (ab79798) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
  • 10% SDS-PAGE showing ab79798 at approximately 57kDa (10µg).

  • Kinase assay: Specific activity 5.9 pmol/min/μg.

References

ab79798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.
I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement with the order number 1140609.
To check the status of the order please contact our Customer Service team and reference this number.
Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know.
I wish you the best of luck with your research.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up