Description

  • Product name

    Recombinant Human AL-1 protein (His tag)
    See all AL-1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab219289 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGV HDRVFDVNDKVENSLEPADDTVHESAEPSRGENLEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      21 to 203
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused to hIgG-His-tag at C-terminus (NP_001953). This product is the full length protein from aa 21 to 203. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab219289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Ephrin A5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • EPLG7
    • AF1
    • AL 1
    • AL-1
    • EFL5
    • Efna5
    • EFNA5_HUMAN
    • EPH-related receptor tyrosine kinase ligand 7
    • Ephrin A5
    • Ephrin-A5
    • EPLG7
    • GLC1M
    • LERK-7
    • LERK7
    • RAGS
    see all
  • Function

    May function actively to stimulate axon fasciculation. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Cell membrane. Membrane > caveola. Compartmentalized in discrete caveolae-like membrane microdomains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab219288.

References

ab219289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up