Overview

  • Product name
    Recombinant Human ALBP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVI TIKSESTFKN TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKW DGKSTTIKRKREDDKLVVECVM KGVTSTRVYERA
    • Amino acids
      1 to 132
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 50% Glycerol

    Buffered with Tris or PBS.

General Info

  • Alternative names
    • A FABP
    • Adipocyte fatty acid binding protein
    • Adipocyte lipid binding protein
    • Adipocyte type fatty acid binding protein
    • AFABP
    • ALBP
    • Ap2
    • FABP 4
    • FABP4
    • Fatty acid binding protein 4
    • Fatty acid binding protein 4 adipocyte
    • Fatty acid binding protein adipocyte
    • Lbpl
    see all
  • Relevance
    ALBP is a fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that the role of these proteins includes fatty acid uptake, transport, and metabolism.
  • Cellular localization
    Cytoplasmic

Images

  • ab166878 is >95% pure by SDS-PAGE.

References

ab166878 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up