Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTD DHVVSGTMVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGK CRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQY TVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFG LGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKP IQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHV LPFEKINEGFDLLHSGKSIRTILMFHHHHHH
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 375
    • Tags

      His tag C-Terminus
    • Additional sequence information

      The predicted N terminal is Met 1 (NP_000658).

Specifications

Our Abpromise guarantee covers the use of ab219442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab219442 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol

General Info

  • Alternative names

    • ADH
    • ADH alpha subunit
    • ADH1
    • ADH1A
    • ADH1A_HUMAN
    • Alcohol dehydrogenase 1
    • Alcohol dehydrogenase 1 (class I), alpha polypeptide
    • Alcohol dehydrogenase 1A
    • Alcohol dehydrogenase 1A (class I), alpha polypeptide
    • Alcohol dehydrogenase subunit alpha
    • Aldehyde reductase
    see all
  • Sequence similarities

    Belongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219442 (3µg).   

References

ab219442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up