Overview

  • Product name

    Recombinant Human Aldehyde dehydrogenase 10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLC KSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQ PLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKL LPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKH LTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCE ASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG GVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDW GKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKKYQAVLRRKALLIFLVVHR LRWSSKQR
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 508

Specifications

Our Abpromise guarantee covers the use of ab132693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ahd 3
    • Ahd 3r
    • Ahd3
    • Ahd3 r
    • AL3A2_HUMAN
    • Aldehyde dehydrogenase 10
    • Aldehyde dehydrogenase 3
    • Aldehyde dehydrogenase 3 family, member A2
    • Aldehyde dehydrogenase family 3 member A2
    • Aldehyde dehydrogenase family 3, subfamily A2
    • Aldehyde dehydrogenase, family 3, subfamily A, member 2
    • ALDH10
    • Aldh3
    • ALDH3A2
    • Aldh4
    • Aldh4 r
    • Aldh4r
    • DKFZp686E23276
    • FALDH
    • Fatty aldehyde dehydrogenase
    • FLJ20851
    • Microsomal aldehyde dehydrogenase
    • msALDH
    • SLS
    see all
  • Function

    Catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length.
  • Involvement in disease

    Defects in ALDH3A2 are the cause of Sjoegren-Larsson syndrome (SLS) [MIM:270200]. SLS is an autosomal recessive neurocutaneous disorder characterized by a combination of severe mental retardation, spastic di- or tetraplegia and congenital ichthyosis (increased keratinization). Ichthyosis is usually evident at birth, neurologic symptoms appear in the first or second year of life. Most patients have an IQ of less than 60. Additional clinical features include glistening white spots on the retina, seizures, short stature and speech defects.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132693 stained with Coomassie Blue.

References

ab132693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up