Overview

  • Product name
    Recombinant Human ALDH16A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLK PEHRNSVPCQDPITGENLASCLQAQAEDVAAAVEAARMAFKGWSAHPGVV RAQHLTRLAEVIQKHQRLLWTLESLVTGRAVREVRDGDVQLAQQLLHYHA IQASTQEEALAGWEPMGVIGLILPPTFSFLEMMWRICPALAVGCTVVALV PPASPAPLLLAQLAGELGPFPGILNVVSGPASLVPILASQPGIRKVAFCG APEEGRALRRSLAGECAELGLALGTESLLLLTDTADVDSAVEGVVDAAWS DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAAC DLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEVP WPVVVASPFRTAKEALLVANGTPRGGSASVWSERLGQALELGYGLQVGTV WINAHGLRDPSVPTGGCKESGCSWHGGPDGLYEYLRPSGTPARLSCLSKN LNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPGARSSRPIRDS SGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE RRKSTLASRLERQGAELKAAEAEVELSARRLRAWGARVQAQGHTLQVAGL RGPVLRLREPLGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACP LLALEVCQDMATVFPAGLANVVTGDRDHLTRCLALHQDVQAMWYFGSAQG SQFVEWASAGNLKPVWASRGCPRAWDQEAEGAGPELGLRVARTKALWLPM GD
    • Amino acids
      1 to 802
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aldehyde dehydrogenase 16 family, member A1
    • Aldehyde dehydrogenase family 16 member A1
    • Aldh16a1
    • ALDH16A1 aldehyde dehydrogenase 16 family, member A1
    • MGC10204
    see all
  • Relevance
    This gene encodes a member of the aldehyde dehydrogenase superfamily. The family members act on aldehyde substrates and use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog, cow, mouse, rat, and zebrafish. The protein encoded by this gene interacts with maspardin, a protein that when truncated is responsible for Mast syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Images

  • ab165245 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up