Recombinant Human ALDH1A1 protein (ab173068)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSSGTPDLPVLLTDLKIQYTKIFINNEWH DSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTM DASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTL RYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVM LIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGY GPTAGAAISSHMDID KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEF AHHGVFYHQGQCCIA ASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKIL DLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPV QQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVN CYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN S
    • Molecular weight
      57 kDa including tags
    • Amino acids
      2 to 501
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab173068 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituent: 0.242% Tris

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Acetaldehyde dehydrogenase 1
    • AHD2
    • AL1A1_HUMAN
    • ALDC
    • Aldehyde dehydrogenase
    • Aldehyde dehydrogenase 1 family member A1
    • Aldehyde dehydrogenase 1 soluble
    • Aldehyde dehydrogenase 1A1
    • Aldehyde dehydrogenase cytosolic
    • Aldehyde dehydrogenase family 1 member A1
    • Aldehyde dehydrogenase liver cytosolic
    • ALDH 1
    • ALDH 1A1
    • ALDH class 1
    • ALDH, liver cytosolic
    • ALDH-E1
    • ALDH1
    • ALDH1 A1
    • ALDH11
    • ALDH1A1
    • ALHDII
    • cytosolic
    • epididymis luminal protein 12
    • epididymis luminal protein 9
    • epididymis secretory sperm binding protein Li 53e
    • HEL-S-53e
    • MGC2318
    • PUMB1
    • RALDH 1
    • RalDH1
    • Retinal dehydrogenase 1
    see all
  • Function
    Binds free retinal and cellular retinol-binding protein-bound retinal. Can convert/oxidize retinaldehyde to retinoic acid.
  • Pathway
    Cofactor metabolism; retinol metabolism.
  • Sequence similarities
    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up