Overview

  • Product name

    Recombinant Human ALDH1B1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVS KKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASE RGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFA GWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPAL ATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIA QHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKP TVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFT RDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLK AYTEVKTVTIKVPQKNS
    • Molecular weight

      83 kDa
    • Amino acids

      1 to 517

Specifications

Our Abpromise guarantee covers the use of ab132677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acetaldehyde dehydrogenase 5
    • AL1B1_HUMAN
    • Aldehyde dehydrogenase 1 family, member B1
    • Aldehyde dehydrogenase 1B1
    • Aldehyde dehydrogenase 5
    • Aldehyde dehydrogenase family 1 member B1
    • Aldehyde dehydrogenase X
    • Aldehyde dehydrogenase X mitochondrial
    • ALDH class 2
    • Aldh1b1
    • ALDH5
    • ALDHX
    • MGC2230
    • mitochondrial
    • Mitochondrial aldehyde dehydrogenase X
    • OTTHUMP00000021399
    see all
  • Function

    ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
  • Tissue specificity

    Liver, testis and to a lesser extent in brain.
  • Pathway

    Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132677 stained with Coomassie Blue.

References

ab132677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up