Overview

  • Product name

    Recombinant Human ALDH8A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAA VKAAREAFPSWSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLA LARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYTVRAPVGVAGL ISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVP PGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKL SLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY SEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVV PFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNCWLI RELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 487

Specifications

Our Abpromise guarantee covers the use of ab132766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AL8A1_HUMAN
    • Aldehyde dehydrogenase 12
    • Aldehyde dehydrogenase 8 family, member A1
    • Aldehyde dehydrogenase family 8 member A1
    • ALDH12
    • Aldh8a1
    • DJ352A20.2
    • DKFZp779D2315
    • MGC138650
    • Raldh4
    see all
  • Function

    Converts 9-cis-retinal to 9-cis-retinoic acid. Has lower activity towards 13-cis-retinal. Has much lower activity towards all-trans-retinal. Has highest activity with benzaldehyde and decanal (in vitro). Has a preference for NAD, but shows considerable activity with NADP (in vitro).
  • Tissue specificity

    Highly expressed in adult kidney and liver. Detected at lower levels in fetal liver and kidney.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132766 stained with Coomassie Blue.

References

ab132766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up