Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQH PDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN
    • Amino acids
      173 to 270
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4 trimethylaminobutyraldehyde dehydrogenase
    • 4-trimethylaminobutyraldehyde dehydrogenase
    • AL9A1_HUMAN
    • aldehyde dehydrogenase (NAD+)
    • Aldehyde dehydrogenase 9A1
    • Aldehyde dehydrogenase E3 isozyme
    • Aldehyde dehydrogenase family 9 member A1
    • ALDH4
    • ALDH7
    • ALDH9
    • aldh9A1
    • E3
    • Gamma aminobutyraldehyde dehydrogenase
    • Gamma-aminobutyraldehyde dehydrogenase
    • R aminobutyraldehyde dehydrogenase
    • R-aminobutyraldehyde dehydrogenase
    • TMABADH
    see all
  • Function
    Converts gamma-trimethylaminobutyraldehyde into gamma-butyrobetaine. Catalyzes the irreversible oxidation of a broad range of aldehydes to the corresponding acids in an NAD-dependent reaction.
  • Tissue specificity
    High expression in adult liver, skeletal muscle, and kidney. Low levels in heart, pancreas, lung and brain. Expressed in all regions of the brain. Expression levels are variable in the different brain areas, with the highest levels in the spinal cord and the lowest in the occipital pole.
  • Pathway
    Amine and polyamine biosynthesis; carnitine biosynthesis.
  • Sequence similarities
    Belongs to the aldehyde dehydrogenase family.
  • Developmental stage
    Strongly expressed in human embryonic brain (gestational age 12 weeks).
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab157876 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up