Description

  • Product name

    Recombinant Human Aldolase C protein
    See all Aldolase C proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE NTEENRRLYR QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTI QDKGIVVGIKVDKGVVPLAGTD GETTTQGLDGLSERCAQYKKDGADFA KWRCVLKISERTPSALAILENANVLARYASICQQ NGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC PI KYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPL PRPWALTF SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQ GKYEGSGEDGGAAAQSLYIA NHAY
    • Predicted molecular weight

      40 kDa
    • Amino acids

      1 to 364

Specifications

Our Abpromise guarantee covers the use of ab222356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl

General Info

  • Alternative names

    • ALDC
    • ALDO C
    • aldoc
    • ALDOC_HUMAN
    • Aldolase 3
    • Aldolase C Fructose bisphosphate
    • Brain type aldolase
    • Brain-type aldolase
    • Fructoaldolase C
    • Fructose 1 6 biphosphate triosephosphate lyase
    • Fructose bisphosphate aldolase C
    • Fructose-bisphosphate aldolase C
    see all
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Sequence similarities

    Belongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

Images

  • Recombinant human Aldolase C (3μg) analysed by 15% SDS-PAGE.

References

ab222356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up