Description

  • Product name

    Recombinant human Aldose reductase protein
    See all Aldose reductase proteins and peptides
  • Biological activity

    Specific activity : approximately 0.5 - 0.6 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • Purity

    > 95 % SDS-PAGE.
    ab117190 is purified by proprietary chromatographic techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF
    • Predicted molecular weight

      36 kDa
    • Amino acids

      1 to 316

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADR
    • AKR1B 1
    • Akr1b1
    • Aldehyde reductase
    • Aldehyde reductase 1
    • Aldo keto reductase family 1, member B1
    • Aldo-keto reductase family 1 member B1
    • aldo-keto reductase family 1, member B1 (aldose reductase)
    • Aldose reductase
    • aldr 1
    • ALDR_HUMAN
    • aldr1
    • ALR2
    • AR
    • Lii5 2 CTCL tumor antigen
    • Low Km aldose reductase
    • MGC1804
    see all
  • Function

    Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
  • Tissue specificity

    Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab117190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Question
Answer

Thank you for your reply.

I spoke to the lab again and this time they were able to supply the raw data that you were asking for. This information is in the Excel file that is attached.

If there is anything else I can help you with, please let me know.

Read More

Question
Answer

Thank you for contacting Abcam.

I have talked to the lab and we are unable to send you the actual raw QC data, but below is the protocol they used to test the activity of ab117190:

Activity Assay:

1. Prepare a 1ml reaction mix into a suitable container : The final concentrations are 0.1M sodium phosphate (pH7.0), 10mM DL-glyceraldehyde, 0.3mM NADPH.
2. Add 50ul of recombinant AKR1B1 solution with various concentrations (2.5ug, 5ug, 10ug) in 750ul reaction buffer.

3. Mix by inversion and Incubate at 25C for 2.5 minutes.

4. Add 200ul of 50 mM DL-glyceraldehyde as a substrate and immediately mix by inversion.

5. Record the increase at A340nm for 3 minutes.

If there is anything else I can help you with, please let me know.

Read More

Answer

Thank you for contacting us today and your interest in our products.

I can now confirm that the specific activity figures I quoted to you over the phone did relate to the most current lot which you have received. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 µM NADPH per minute at 25°C.

For the lot number GR101457-1 which you received, this value was between 0.5 - 0.6 units/mg.

I hope this information has been of help. If you have any further questions, please do not hesitate to ask.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up