Overview

  • Product name

    Recombinant Human ALEX1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYS FNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTY ISQVCDDT
    • Amino acids

      188 to 295
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARMCX 1
    • AD032
    • ALEX1
    • ARM protein lost in epithelial cancers on chromosome X 1
    • Arm protein lost in epithelial cancers X chromosome 1
    • Armadillo repeat containing X linked 1
    • Armadillo repeat containing X linked protein 1
    • Armadillo repeat-containing X-linked protein 1
    • ARMCX1
    • ARMX1_HUMAN
    • Protein ALEX1
    see all
  • Tissue specificity

    Expressed at high levels ovary, heart, testis, prostate, brain, spleen and colon. Expressed at very low levels in liver and thymus. Not expressed in peripheral blood leukocytes. Not or reduced expressed in lung, prostate, colon, pancreas and ovarian carcinomas.
  • Sequence similarities

    Contains 3 ARM repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162504 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up