Overview

  • Product name
    Recombinant Human ALG10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLL
    • Amino acids
      48 to 97
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALG 10
    • ALG10A
    • Alpha 1,2 glucosyltransferase ALG10 A
    • Alpha 2 glucosyltransferase ALG10 A
    • Alpha2 glucosyltransferase
    • Asparagine linked glycosylation 10 alpha 1,2 glucosyltransferase homolog (S. pombe)
    • Asparagine linked glycosylation 10 alpha 1,2 glucosyltransferase homolog (yeast)
    • Asparagine linked glycosylation 10 homolog (yeast, alpha 1,2 glucosyltransferase)
    • Asparagine linked glycosylation protein 10 homolog A
    • Derepression of ITR1 expression 2 homolog
    • DIE2
    • FLJ14751
    • KCR1
    • Potassium channel regulator 1
    see all
  • Relevance
    ALG10 encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go(EAG) potassium ion channel.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein

Images

  • ab164694 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up