Description

  • Product name

    Recombinant Human ALG13 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEP FSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVI NEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQP EKFSAFLDKVVGLQK
    • Amino acids

      1 to 165
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GLT28D1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ALG13
    • ALG13, S. cerevisiae, homolog of
    • ALG13, UDP-N-acetylglucosaminyltransferase subunit
    • ALG13_HUMAN
    • Asparagine linked glycosylation 13 homolog (S. cerevisiae)
    • Asparagine-linked glycosylation 13 homolog
    • Asparagine-linked glycosylation 13, S. cerevisiae, homolog of
    • CDG1S
    • CXorf45
    • FLJ23018
    • FLJ31785
    • GLT28D1
    • Glycosyltransferase 28 domain containing protein 1
    • Glycosyltransferase 28 domain-containing 1
    • Glycosyltransferase 28 domain-containing protein 1
    • Hematopoietic stem/progenitor cells protein MDS031
    • MDS031
    • MGC12423
    • N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
    • OTTHUMP00000062812
    • OTTHUMP00000176862
    • TDRD13
    • tudor domain containing 13
    • UDP N acetylglucosamine transferase subunit ALG13 homolog
    • UDP-N-acetylglucosamine transferase subunit ALG13 homolog
    • YGL047W
    see all
  • Function

    Isoform 2 may be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway.
  • Sequence similarities

    Belongs to the glycosyltransferase 28 family.
    Contains 1 OTU domain.
    Contains 1 Tudor domain.
  • Cellular localization

    Endoplasmic reticulum. Could be recruited to the cytosolic face of the endoplasmic reticulum membrane through its interaction with ALG14.
  • Information by UniProt

Images

  • ab164144 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up