Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLR RAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFD KGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAA KHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFF LKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHC IMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDF SDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLN LPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREI LDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLD KAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVN VLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALS VTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLRE EVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPT KPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQG PPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQ QPSYPFPQPPQQSYYPQQ
    • Molecular weight

      121 kDa including tags
    • Amino acids

      1 to 868
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AIP1
    • ALG 2 interacting protein 1
    • ALG-2-interacting protein 1
    • ALG2 interacting protein X
    • Alix
    • Apoptosis linked gene 2 interacting protein X
    • Dopamine receptor interacting protein 4
    • DRIP4
    • Hp95
    • KIAA1375
    • MGC17003
    • PDC6I_HUMAN
    • PDCD6 interacting protein
    • PDCD6-interacting protein
    • PDCD6IP
    • Programmed cell death 6 interacting protein
    • Programmed cell death 6-interacting protein
    see all
  • Function

    Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). Appears to be an adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis. Involved in HIV-1 virus budding. Can replace TSG101 it its role of supporting HIV-1 release; this function implies the interaction with CHMP4B. May play a role in the regulation of both apoptosis and cell proliferation.
  • Sequence similarities

    Contains 1 BRO1 domain.
  • Cellular localization

    Cytoplasm > cytosol. Melanosome. Cytoplasm > cytoskeleton > centrosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Colocalized with CEP55 in the midbody during cytokinesis. Colocalized with CEP55 at centrosomes of non-dividing cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up