Recombinant Human Alkaline Phosphatase, Tissue Non-Specific protein (ab152014)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTV TAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAY LCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTT RVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDV IMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSH FIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAI QILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTS SEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGN GPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPM AHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSVDVHHHHHH
    • Molecular weight

      55 kDa including tags
    • Amino acids

      18 to 502
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.001% Zinc chloride, 0.48% HEPES, 0.88% Sodium chloride, 0.02% Magnesium sulphate

General Info

  • Alternative names

    • AKP2
    • Alkaline phosphatase liver/bone/kidney
    • Alkaline phosphatase liver/bone/kidney isozyme
    • Alkaline phosphatase tissue nonspecific isozyme
    • Alkaline phosphatase, tissue-nonspecific isozyme
    • Alkaline phosphomonoesterase
    • Alpl
    • AP TNAP
    • AP-TNAP
    • APTNAP
    • BAP
    • FLJ40094
    • FLJ93059
    • Glycerophosphatase
    • HOPS
    • Liver/bone/kidney type alkaline phosphatase
    • MGC161443
    • MGC167935
    • PHOA
    • PPBT_HUMAN
    • Tissue non specific alkaline phosphatase
    • Tissue nonspecific ALP
    • TNAP
    • TNSALP
    see all
  • Function

    This isozyme may play a role in skeletal mineralization.
  • Involvement in disease

    Hypophosphatasia
    Hypophosphatasia childhood type
    Hypophosphatasia infantile type
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab152014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up