Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAH AARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFI FIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEF LRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLS EQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQ SAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEG LPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
    • Molecular weight
      68 kDa including tags
    • Amino acids
      1 to 389

Specifications

Our Abpromise guarantee covers the use of ab132191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABH
    • ABH1
    • alkB
    • alkB homolog 1 histone H2A dioxygenase
    • AlkB, alkylation repair homolog 1 (E. coli)
    • ALKB1_HUMAN
    • ALKBH
    • ALKBH1
    • Alkylated DNA repair protein alkB homolog 1
    • Alkylation repair homolog 1
    • Alkylation repair, alkB homolog
    • Alpha-ketoglutarate-dependent dioxygenase ABH1
    • DNA lyase ABH1
    • DNA oxidative demethylase ALKBH1
    • hABH
    see all
  • Function
    Dioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation (By similarity). Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketoglutarate and iron.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization
    Mitochondrion. Nucleus. Mainly localizes in euchromatin, largely excluded from heterochromatin and nucleoli.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132191 stained with Coomassie Blue.

References

ab132191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up