Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDRFLVKGAQGGLLRKQEEQEPTGEEPAVL GGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYTVLFGKAEADE IFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLS PKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAP GSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPT NTHWYHSLPVRKKVLAPRVNLTFRKILLTKK
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 261
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105622 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    Previously labelled as ABH2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol

General Info

  • Alternative names
    • 2OG Fe(II) oxy DC1
    • 9530023G02
    • ABH 2
    • ABH2
    • alkB alkylation repair homolog 2
    • ALKB2_HUMAN
    • ALKBH2
    • ALKBH2 alkB
    • Alkylated DNA repair protein alkB homolog
    • Alkylated DNA repair protein alkB homolog 2
    • Alkylation repair homolog 2
    • Alpha ketoglutarate dependent dioxygenase alkB homolog 2
    • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
    • AU016977
    • DNA oxidative demethylase ALKBH2
    • EC 1.14.11.
    • FLJ99103
    • hABH2
    • mABH2
    • MGC90512
    • Oxy DC1
    see all
  • Function
    Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine (in vitro). Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificity
    Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.
  • Sequence similarities
    Belongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization
    Nucleus. Detected in replication foci during S-phase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab105622 (3µg)

References

ab105622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for your call today and letting us know about the trouble with ab105622.

As we discussed, I'd be happy to give you a 20% discount on another vial of ab105622 or alternatively you can participate in our testing discount program. In this testing program, you would need to submit a review of ab105622 in a functional assay, and in exchange we will give you one free protein on a future order within the next 4 months.

Please let me know which of these options you would like, and I will set it up promptly. Let me know if you have any further questions or if there is anything else that we can do for you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up