For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-alkbh2-protein-ab105622.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA Damage & Repair Direct Chemical Reversal
Share by email

Recombinant Human ALKBH2 protein (ab105622)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human ALKBH2 protein (ab105622)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 90% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE, MS

    Description

    • Product name

      Recombinant Human ALKBH2 protein
    • Purity

      > 90 % SDS-PAGE.
      ab105622 was purified using conventional chromatography techniques.
    • Expression system

      Escherichia coli
    • Accession

      Q6NS38
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMDRFLVKGAQGGLLRKQEEQEPTGEEPAVL GGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYTVLFGKAEADE IFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLS PKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAP GSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPT NTHWYHSLPVRKKVLAPRVNLTFRKILLTKK
      • Predicted molecular weight

        31 kDa including tags
      • Amino acids

        1 to 261
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)

    Specifications

    Our Abpromise guarantee covers the use of ab105622 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Mass Spectrometry

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Additional notes

      Previously labelled as ABH2. 

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • 2OG Fe(II) oxy DC1
      • 9530023G02
      • ABH 2
      • ABH2
      • alkB alkylation repair homolog 2
      • ALKB2_HUMAN
      • ALKBH2
      • ALKBH2 alkB
      • Alkylated DNA repair protein alkB homolog
      • Alkylated DNA repair protein alkB homolog 2
      • Alkylation repair homolog 2
      • Alpha ketoglutarate dependent dioxygenase alkB homolog 2
      • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
      • AU016977
      • DNA oxidative demethylase ALKBH2
      • EC 1.14.11.
      • FLJ99103
      • hABH2
      • mABH2
      • MGC90512
      • Oxy DC1
      see all
    • Function

      Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine (in vitro). Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
    • Tissue specificity

      Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.
    • Sequence similarities

      Belongs to the alkB family.
      Contains 1 Fe2OG dioxygenase domain.
    • Cellular localization

      Nucleus. Detected in replication foci during S-phase.
    • Target information above from: UniProt accession Q6NS38 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human ALKBH2 protein (ab105622)
      SDS-PAGE - Recombinant Human ALKBH2 protein (ab105622)

      15% SDS-PAGE analysis of ab105622 (3µg)

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab105622? Please let us know so that we can cite the reference in this datasheet.

    ab105622 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    This ABH2 protein lost activity after being stored at -20C for around 8 months.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 26 2012

    Answer

    Thank you for your call today and letting us know about the trouble with ab105622.

    As we discussed, I'd be happy to give you a 20% discount on another vial of ab105622 or alternatively you can participate in our testing discount program. In this testing program, you would need to submit a review of ab105622 in a functional assay, and in exchange we will give you one free protein on a future order within the next 4 months.

    Please let me know which of these options you would like, and I will set it up promptly. Let me know if you have any further questions or if there is anything else that we can do for you.

    Read More

    Abcam Scientific Support

    Answered on Apr 26 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.