Description

  • Product name

    Recombinant Human alpha 1 Fetoprotein + PD1
  • Purity

    > 90 % SDS-PAGE.
    Expressed in E.coli as inclusion bodies. ab190415 was refolded using “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSG GSNIEFPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFV LNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRAR RNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAG QFQTLV
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      21 to 170
    • Additional sequence information

      Extracellular domain, with AFP tag (Human Alpha-Fetal Protein N-terminal domain: 1-198 aa) at N terminal end of PD1.

Specifications

Our Abpromise guarantee covers the use of ab190415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab190415 may be used for:

    1. 1. In vitro pro-B and T cells differentiation regulation study with this protein as either coating matrix protein or soluble factor.
    2. 2. May be used for protein-protein interaction assay.
    3. 3. As potential diagnostic biomarker protein for monitoring NK, B and T cell activities in vivo.
    4. 4. As antigen for specific antibody production.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Sterile-filtered, contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Cellular localization

    alpha 1 Fetoprotein: Secreted. PD1: Membrane.

References

ab190415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up