Description

  • Product name

    Recombinant Human alpha 1 Fetoprotein
    See all alpha 1 Fetoprotein proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIF FAQFVQEATYKEVSKMVKDALTAIE KPTGDEQSSGCLENQLPAFLEEL CHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSC EA YEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAE NAVECFQTKAATVTKELRESSLLNQHACA VMKNFGTRTFQAITVTKLS QKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDT LSNKIT ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQF SSGEKNIFLASFVHEYSRRHPQLAVSVILRVAK GYQELLEKCFQTENP LECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAP QLTSSELMAI TRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRH EMTPVNTGVGQCCTSSYANRRPCFSSLVVDETYVPPA FSDDKFIFHKD LCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQ EQEVCFAEEGQKLI SKTRAALGV
    • Predicted molecular weight

      93 kDa including tags
    • Amino acids

      1 to 609

Specifications

Our Abpromise guarantee covers the use of ab114216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Best use within three months from the date of receipt of this protein.
    Protein concentration is lot specific and is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Afp
    • AFPD
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • Function

    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificity

    Plasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stage

    Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications

    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab114216 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

This product has been referenced in:

  • Zhang A  et al. A Chemiluminescent Protein Microarray Method for Determining the Seroglycoid Fucosylation Index. Sci Rep 6:31132 (2016). Read more (PubMed: 27528397) »
See 1 Publication for this product

Customer reviews and Q&As

Question
Answer

Thank you for your enquiry.


The purity of ab114216 varies from batch to batch.

Generally, the purity is above 80%.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up