Description

  • Product name

    Recombinant Human alpha 2 Macroglobulin protein
    See all alpha 2 Macroglobulin proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
    • Amino acids

      641 to 730
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A2m
    • A2MG_HUMAN
    • Alpha 2 M
    • Alpha 2M
    • Alpha-2-M
    • Alpha-2-macroglobulin
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
    • CPAMD5
    • DKFZp779B086
    • FWP007
    • S863 7
    see all
  • Function

    Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
  • Tissue specificity

    Secreted in plasma.
  • Sequence similarities

    Belongs to the protease inhibitor I39 (alpha-2-macroglobulin) family.
  • Developmental stage

    Contrary to the rat protein, which is an acute phase protein, this protein is always present at high levels in circulation.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab157817 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up