Recombinant Human alpha 5 Defensin protein (ab158273)

Overview

  • Product name
    Recombinant Human alpha 5 Defensin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNG LSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
    • Amino acids
      1 to 94
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha 5
    • DEF5
    • DEF5_HUMAN
    • Defa
    • Defa29
    • DEFA5
    • Defcr29
    • Defcr5
    • Defensin
    • Defensin 5
    • Defensin alpha 5
    • Defensin alpha 5 Paneth cell specific
    • Defensin alpha 5 preproprotein
    • Enteric defensin
    • HD 5
    • HD5
    • HD5(20-94)
    • HD5(63-94)
    • MGC129728
    • RD 5
    see all
  • Function
    Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing.
  • Tissue specificity
    Paneth cells of the small intestine (at protein level).
  • Sequence similarities
    Belongs to the alpha-defensin family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Secreted. Cytoplasmic vesicle > secretory vesicle. Peptides HD5(20-94), HD5(23-94) and HD5(29-94) are found within tissues, HD5(20-94) being the predominant intracellular form. Peptides HD5(56-94) and HD5(63-94) are found in the extracellular milieu, HD5(63-94) being the most abundant form.
  • Information by UniProt

Images

  • ab158273 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up