Description

  • Product name

    Recombinant Human alpha Actinin/ACTN1 protein
    See all alpha Actinin/ACTN1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab207132 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMDHYDSQQTNDYMQPEEDWDRDLLL DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGE RLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKD GLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAE DIVGTARPDEKAIMTYVSSFYHAF
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1 to 249
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001123476.

Specifications

Our Abpromise guarantee covers the use of ab207132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as alpha Actinin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% PBS, 10% Glycerol

General Info

  • Alternative names

    • actinin 1 smooth muscle
    • Actinin alpha 1
    • actinin, alpha 1
    • ACTN 1
    • Actn1
    • ACTN1_HUMAN
    • Alpha Actinin 1
    • Alpha actinin cytoskeletal isoform
    • Alpha-actinin cytoskeletal isoform
    • Alpha-actinin-1
    • BDPLT15
    • F actin cross linking protein
    • F-actin cross-linking protein
    • FLJ40884
    • FLJ54432
    • Non muscle alpha actinin 1
    • Non-muscle alpha-actinin-1
    see all
  • Function

    F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
  • Sequence similarities

    Belongs to the alpha-actinin family.
    Contains 1 actin-binding domain.
    Contains 2 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
    Contains 4 spectrin repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with MYOZ2 and PPP3CA at the Z-line of heart and skeletal muscle.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab207132.

References

ab207132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up