Overview

  • Product name
    Recombinant Human alpha Internexin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVAS SAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQG LNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDL RAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQ RDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAA EVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAE VAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLL EGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE EEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI
    • Amino acids
      1 to 499
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 66 kDa neurofilament protein
    • AINX_HUMAN
    • Alpha Inx
    • Alpha-internexin
    • Alpha-Inx
    • INA
    • Internexin neuronal intermediate filament protein alpha
    • MGC12702
    • NEF 5
    • NEF5
    • Neurofilament 5
    • Neurofilament 5 (66kD)
    • Neurofilament 66
    • Neurofilament 66 tax binding protein
    • Neurofilament-66
    • NF 66
    • NF-66
    • NF66
    • TXBP 1
    • TXBP1
    see all
  • Function
    Class-IV neuronal intermediate filament that is able to self-assemble. It is involved in the morphogenesis of neurons. It may form an independent structural network without the involvement of other neurofilaments or it may cooperate with NF-L to form the filamentous backbone to which NF-M and NF-H attach to form the cross-bridges.
  • Tissue specificity
    Found predominantly in adult CNS.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Developmental stage
    Expressed in brain as early as the 16th week of gestation, and increased rapidly and reached a steady state level by the 18th week of gestation.
  • Post-translational
    modifications
    O-glycosylated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab160346 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up