Description

  • Product name

    Recombinant Human Alpha SNAP protein
  • Purity

    > 95 % SDS-PAGE.
    ab100963 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDNSGKEAEAMALLAEAERKVKNSQSFFSG LFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD AATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEI YETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEE LFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML LRIKKTIQGDEEDLR
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 295
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Alpha soluble NSF attachment protein
    • Alpha-soluble NSF attachment protein
    • N ethylmaleimide sensitive factor attachment protein alpha
    • N-ethylmaleimide-sensitive factor attachment protein alpha
    • napA
    • NSF attachment protein alpha
    • SNAA_HUMAN
    • SNAP alpha
    • SNAP-alpha
    • SNAPA
    see all
  • Function

    Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
  • Sequence similarities

    Belongs to the SNAP family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab100963 (3 µg) at approximately 35.3 kDa.

References

ab100963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us last week and your interest in our products.

As discussed over the phone, we do not have the plasmid which was used to express the protein ab100963 in our catalogue. Unfortunately, I can now confirm that the source of this product is also not able to supply this to you. I am sorry I could not be of more help.

If you have any further questions, please do not hesitate to contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up