Recombinant Human Alpha SNAP protein (ab169891)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSS KIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFV DAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELV DIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYE QVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFS DSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKT IQGDEEDLR
    • Molecular weight
      35 kDa including tags
    • Amino acids
      2 to 295
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The protein was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer contains Sodium chloride, Potassium chloride, EDTA, Arginine, DTT and Glycerol.

General Info

  • Alternative names
    • Alpha soluble NSF attachment protein
    • Alpha-soluble NSF attachment protein
    • N ethylmaleimide sensitive factor attachment protein alpha
    • N-ethylmaleimide-sensitive factor attachment protein alpha
    • napA
    • NSF attachment protein alpha
    • SNAA_HUMAN
    • SNAP alpha
    • SNAP-alpha
    • SNAPA
    see all
  • Function
    Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
  • Sequence similarities
    Belongs to the SNAP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab169891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up